PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004509216.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 292aa    MW: 33054.2 Da    PI: 7.0408
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004509216.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.83.8e-3851041100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+C++ C lapyfp e+p++f nvh +FG snv+kll++l+ ++re+a++s vyeAear+rdPvyG+vg+++ lq++l++ + +++
  XP_004509216.1   5 PCAACKFLRRRCEATCDLAPYFPPEHPQRFINVHTVFGKSNVSKLLSELDAKQREEAVKSFVYEAEARLRDPVYGCVGLVSVLQHRLREIQIDIE 99 
                     7********************************************************************************************99 PP

          DUF260  96 llkee 100
                      +k+e
  XP_004509216.1 100 NAKKE 104
                     99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5284105IPR004883Lateral organ boundaries, LOB
PfamPF031959.1E-385102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MTTHPCAACK FLRRRCEATC DLAPYFPPEH PQRFINVHTV FGKSNVSKLL SELDAKQREE  60
AVKSFVYEAE ARLRDPVYGC VGLVSVLQHR LREIQIDIEN AKKELVHYLP PDVIQSALAN  120
PDAFFAQQNN PNFPPLTLSN SGSRRNLVIC DTQRMPIAPP QSVIHDSQQR STVPPPNDGG  180
ILVNRNTQQR PTIPWENIMA RRRQLTIRDN FPRPTVTPPS HTVSVDGGEL IMREAKKLLN  240
IEHVGKYPND HTELNCTNDD SVRVRAVVLP FDGFDNSSND DNQNHQQGEQ EQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004509216.10.0PREDICTED: LOB domain-containing protein 15-like
TrEMBLA0A0B2S5T24e-53A0A0B2S5T2_GLYSO; LOB domain-containing protein 36
TrEMBLK7LN934e-53K7LN93_SOYBN; Uncharacterized protein
STRINGGLYMA11G06210.21e-52(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-51ASYMMETRIC LEAVES 2-like 1